Analytical Data
-
Gene name
GRPEL2
- Application
-
Alternative Names
GrpE like 2; mitochondrial; GrpE protein homolog 2; GRPE2_HUMAN; GRPEL 2; Grpel2; mitochondrial; Mt GrpE#2; Mt-GrpE#2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TAA5
-
Expression Region
1-225aa
-
AA Sequence
MAVRSLWAGRLRVQRLLAWSAAWESKGWPLPFSTATQRTAGEDCRSEDPPDELGPPLAERALRVKAVKLEKEVQDLTVRYQRAIADCENIRRRTQRCVEDAKIFGIQSFCKDLVEVADILEKTTECISEESEPEDQKLTLEKVFRGLLLLEAKLKSVFAKHGLEKLTPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL
-
Molecular Weight
51.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GRPEL2 (GTPase-Related Protein with EF-Hand Motifs 2) is a significant member of the molecular chaperone family, primarily involved in the mitochondrial protein import and folding processes. Understanding the function of GRPEL2 is crucial due to its role in maintaining mitochondrial homeostasis and its potential implications in various diseases, particularly those related to mitochondrial dysfunction. Research into GRPEL2 has gained traction as scientists seek to elucidate its mechanism of action, interactions with other proteins, and its role in cellular stress responses. Recent studies have highlighted the importance of GRPEL2 in facilitating the proper folding and assembly of mitochondrial proteins, specifically in the context of the mitochondrial import machinery. Additionally, its involvement in the regulation of apoptosis and cellular metabolism adds further interest to its study, linking it to broader metabolic diseases and neurodegenerative conditions. Given the increasing prevalence of mitochondrial-related disorders, GRPEL2 presents a promising target for therapeutic intervention, prompting research aimed at developing strategies to modulate its function. The ongoing exploration of GRPEL2 through recombinant protein studies, structural analyses, and interaction mapping will contribute significantly to our understanding of mitochondrial biology and the development of novel treatment approaches.
