Analytical Data
-
Gene name
GRLF1
- Application
-
Alternative Names
ARHGAP35; GAP associated protein p190; Glucocorticoid receptor DNA binding factor 1; Glucocorticoid receptor DNA-binding factor 1; Glucocorticoid receptor repression factor 1; GRF 1; GRF-1; GRF1; GRLF 1; GRLF1; GRLF1_HUMAN; KIAA1722; MGC10745; p190 A; p190-A; P190A; P190A; rat; homolog of; p190ARhoGAP; p190RhoGAP; Rho GAP p190A; Rho GTPase-activating protein 35
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NRY4
-
Expression Region
1-36aa
-
AA Sequence
MEATSRSVHGDVGEVGHFEGMAVCWCPRRGILPGLR
-
Molecular Weight
29.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GRLF1 (G-rich RNA-binding factor 1) is a transcription factor that plays a crucial role in the regulation of gene expression, particularly in response to environmental stresses. Recent studies have highlighted its significant involvement in various biological processes, such as cellular proliferation, differentiation, and apoptosis. GRLF1 has been associated with the regulation of several key genes involved in stress responses, making it an important focus for researchers seeking to understand the molecular mechanisms underlying stress tolerance in plants and other organisms. Moreover, its potential role in human diseases, including cancer, has prompted investigations into its function and interactions within cellular pathways. To elucidate GRLF1's mechanisms of action, the production of recombinant GRLF1 protein has become essential for in vitro studies, allowing researchers to analyze its binding properties, post-translational modifications, and interactions with other proteins or RNA molecules. By generating and characterizing this recombinant protein, researchers aim to gain insights into GRLF1's multifaceted roles and its potential applications in biotechnology and medicine, ultimately contributing to the development of strategies to enhance stress resistance in crops or to identify new therapeutic targets for disease treatment.
