Analytical Data
-
Gene name
FDCSP
- Application
-
Alternative Names
FDCSP；C4orf7;Follicular dendritic cell secreted peptide
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NFU4
-
Expression Region
18-85aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSFPVSQDQEREKRSISDSDELASGFFVF PYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPLPSEK
-
Molecular Weight
10 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FDCSP, or Frizzled Domain Containing S protein, is a novel protein implicated in various cellular processes and signaling pathways. Its role in the Wnt signaling pathway, which is crucial for cell proliferation, differentiation, and tissue homeostasis, has garnered significant attention in recent years. Given the importance of Wnt signaling in developmental biology and its association with various diseases, including cancer, understanding FDCSP's structure and function could illuminate potential therapeutic targets. The recombinant expression of FDCSP provides an advantageous approach to studying its biological properties and interactions. Through methodologies such as recombinant DNA technology, researchers can produce FDCSP in host systems, allowing for the examination of its functional role in a controlled environment. Furthermore, the investigation of its interactions with other proteins and cellular components may uncover new insights into cellular signaling networks, potentially leading to novel intervention strategies for Wnt-related pathologies. Overall, the study of FDCSP as a recombinant protein represents a promising avenue for advancing our understanding of both fundamental biological processes and their implications in health and disease.
