Analytical Data
-
Gene name
GART
- Application
-
Alternative Names
GART；PGFT；PRGS；Trifunctional purine biosynthetic Protein adenosine-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P22102
-
Expression Region
111–318aa
-
AA Sequence
KEFMDRHGIPTAQWKAFTKPEEACSFILSADFPALVVKASGLAAGKGVIVAKSKEEACKAVQEIMQEKAFGAAGETIVIEELLDGEEVSCLCFTDGKTVAPMPPAQDHKRLLEGDGGPNTGGMGAYCPAPQVSNDLLLKIKDTVLQRTVDGMQQEGTPYTGILYAGIMLTKNGPKVLEFNCRFGDPECQVILPLLKSDLYEVIQSTLD
-
Molecular Weight
26.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GART (generating amino acid-rich transmembrane) is a pivotal protein involved in several biological processes, including nucleotide synthesis and cellular stress response. Its multifaceted roles make it an attractive target for researchers focusing on metabolic disorders and cancer. The GART protein is part of the purine biosynthesis pathway, facilitating the conversion of amino acids into critical nucleotide precursors. Dysregulation of this pathway is often linked to various diseases, including certain types of cancer. Recent advances in protein engineering and structural biology have provided insights into GART's conformational dynamics and interactions with other cellular components. As a result, researchers are exploring GART as a potential biomarker for disease progression and as a target for therapeutic interventions. Additionally, the development of GART-derived recombinant proteins may allow for the creation of novel treatments that enhance the efficacy of existing therapies. The ongoing investigation into GART's structure-function relationships aims to unravel the complexities of its biological activities and improve our understanding of its role in health and disease. With the rising incidence of metabolic disorders and cancer, GART research holds significant promise for contributing to innovative diagnostic and therapeutic strategies.
