Analytical Data
-
Gene name
RT0041
- Application
-
Alternative Names
RT0041；
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q68XW4
-
Expression Region
1-259aa
-
AA Sequence
MLLNIANLVGKHTIKFAQSVGIFALFSFIAISSIIKPPLYLSLIMRQLLFIGFHSLPVVAMTTFFSGAVLALQSYTGFSRFSAENSIATVVVLSLTRELGPVLAGLIVAGRVGASIAAEIATMKVTEQVDALYTLSTDPIKYLVCPRVIAAIITMPCLVLIGDVIGVMGGYLVGIYKLNFNSTAYLTSTFQYLELIDVISGLVKATVFGFIISIISCYSGYYSGKGAKGVGRATTSAVVNSSILILISNYLITELLFKV
-
Molecular Weight
27.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RT0041 is a recombinant protein that has garnered attention in recent years due to its potential applications in biomedical research and therapeutic development. The protein is derived from a specific genetic sequence, which allows for its expression in host systems such as bacteria or yeast, enabling large-scale production. The study of RT0041 is particularly relevant in the context of understanding its structural and functional properties, as well as its interactions with other biomolecules. Initial research has indicated that RT0041 may play a role in important biological processes, including cell signaling and immune response modulation. Additionally, its unique biochemical characteristics suggest that it could serve as a valuable tool for drug discovery, particularly in targeting specific diseases where traditional therapies have been inadequate. As such, ongoing investigations focus not only on refining the methods for its production but also on exploring its mechanisms of action and potential therapeutic applications. This research is crucial for advancing our understanding of protein functions in health and disease, paving the way for innovative treatment strategies.
