Cat: PA2000-3909

Recombinant Human RT0041 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RT0041

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RT0041;

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q68XW4

  • Expression Region

    1-259aa

  • AA Sequence

    MLLNIANLVGKHTIKFAQSVGIFALFSFIAISSIIKPPLYLSLIMRQLLFIGFHSLPVVAMTTFFSGAVLALQSYTGFSRFSAENSIATVVVLSLTRELGPVLAGLIVAGRVGASIAAEIATMKVTEQVDALYTLSTDPIKYLVCPRVIAAIITMPCLVLIGDVIGVMGGYLVGIYKLNFNSTAYLTSTFQYLELIDVISGLVKATVFGFIISIISCYSGYYSGKGAKGVGRATTSAVVNSSILILISNYLITELLFKV

  • Molecular Weight

    27.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RT0041 is a recombinant protein that has garnered attention in recent years due to its potential applications in biomedical research and therapeutic development. The protein is derived from a specific genetic sequence, which allows for its expression in host systems such as bacteria or yeast, enabling large-scale production. The study of RT0041 is particularly relevant in the context of understanding its structural and functional properties, as well as its interactions with other biomolecules. Initial research has indicated that RT0041 may play a role in important biological processes, including cell signaling and immune response modulation. Additionally, its unique biochemical characteristics suggest that it could serve as a valuable tool for drug discovery, particularly in targeting specific diseases where traditional therapies have been inadequate. As such, ongoing investigations focus not only on refining the methods for its production but also on exploring its mechanisms of action and potential therapeutic applications. This research is crucial for advancing our understanding of protein functions in health and disease, paving the way for innovative treatment strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US