Analytical Data
-
Gene name
GPR3
- Application
-
Alternative Names
GPR3; ACCA; G-protein coupled receptor 3; ACCA orphan receptor
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P46089
-
Expression Region
1-330aa
-
AA Sequence
MMWGAGSPLAWLSAGSGNVNVSSVGPAEGPTGPAAPLPSPKAWDVVLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAAVFCIGSAEMSLVLVGVLAMAFTASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDAHSPPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV
-
Molecular Weight
62.04 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR3, a member of the G protein-coupled receptor (GPCR) family, plays a significant role in various physiological processes, including neurodevelopment and reproductive functions. Its enigmatic function, particularly in the central nervous system, has generated considerable interest in the scientific community. Unlike many GPCRs, GPR3 is known to be constitutively active and modulates intracellular signaling pathways even in the absence of traditional ligands. This characteristic positions GPR3 as a potential target for drug design, especially in the context of neurodegenerative diseases and metabolic disorders. Recent studies have indicated that GPR3 can influence neuronal survival and plasticity, contributing to the understanding of its role in brain health and disease. Moreover, the structural and functional studies of GPR3, facilitated by the production of recombinant proteins, have provided insights into its signaling mechanisms and interactions with other cellular proteins. As researchers continue to explore the therapeutic potential of targeting GPR3, the development of GPR3 recombinant proteins has emerged as a pivotal strategy for elucidating its biological functions and guiding future pharmacological interventions.
