Analytical Data
-
Gene name
GPR34
- Application
-
Alternative Names
GPR34; Probable G-protein coupled receptor 34
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UPC5
-
Expression Region
1-381aa
-
AA Sequence
MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDEKLLSTVLTTSYSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKWTLGVILCKVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWMLALGGFLTMIILTLKKGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIKIGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCYWKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFKPGYSLHDTSVAVKIQSSSKST
-
Molecular Weight
70.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR34, a member of the G protein-coupled receptor (GPCR) family, has garnered significant research interest due to its unique expression patterns and potential roles in various physiological and pathological processes. Initially identified in immune cells, GPR34 has been implicated in modulating inflammatory responses, making it a candidate for therapeutic exploration in autoimmune diseases. Recent studies suggest that GPR34 may also play a role in the central nervous system, influencing neuroinflammation and neurodegenerative disorders. The receptor's natural ligands and downstream signaling pathways remain largely unexplored, presenting a gap in understanding its functional mechanisms. To address this, researchers have developed recombinant GPR34 proteins to facilitate structural and functional characterization. These studies aim to elucidate the receptor's binding affinities, activation states, and interaction with various ligands, paving the way for potential drug development. As GPCRs are commonly targeted in pharmacology, insights gained from GPR34 research may contribute to novel therapeutic strategies for treating conditions linked to immune dysregulation and neuroinflammation. The continued investigation of GPR34 presents a promising avenue for understanding its biological significance and therapeutic potential in diverse medical fields.
