Analytical Data
-
Gene name
FPR2
- Application
-
Alternative Names
FPR2；FPRH1；FPRL1；LXA4R；N-formyl peptide receptor 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P25090
-
Expression Region
1-351aa
-
AA Sequence
METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
-
Molecular Weight
40.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FPR2, or Formyl Peptide Receptor 2, is a member of the G protein-coupled receptor (GPCR) family and plays a crucial role in the immune response and inflammation. It is primarily expressed in immune cells such as neutrophils and macrophages, where it mediates the chemotactic response to formylated peptides, guiding these cells to sites of infection or injury. Research into FPR2 has gained momentum due to its potential implications in various pathological conditions, including autoimmune diseases, cancer, and neurodegenerative disorders. The receptor's ability to recognize both host-derived and microbial cues makes it a key player in distinguishing between self and non-self, which is essential for maintaining homeostasis in the immune system. Furthermore, studies have shown that FPR2 can influence the activation of leukocytes and modulate the release of pro-inflammatory cytokines, linking it to the regulation of inflammation. The development of recombinant FPR2 proteins allows for advanced studies into its structure-function relationships and interactions with ligands, as well as potential therapeutic applications. Through the study of FPR2 and its recombinant forms, researchers hope to elucidate novel mechanisms of immune modulation and identify new drug targets to combat diseases associated with dysregulated immune responses. Understanding the biology of FPR2 may provide insights into its role in health and disease, paving the way for innovative strategies in immunotherapy and personalized medicine.
