Analytical Data
-
Gene name
GPR37L1
- Application
-
Alternative Names
GPR37L1; ETBRLP2; G-protein coupled receptor 37-like 1; Endothelin B receptor-like protein 2; ETBR-LP-2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60883
-
Expression Region
27-130aa
-
AA Sequence
PLHLGRHRAETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRPIHPAGLQPTKPLVATSPNPDKDGGTPDSGQELRGNLTGAPGQRLQIQNPLYPVTESSYSA
-
Molecular Weight
37.18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR37L1, also known as the G protein-coupled receptor 37-like 1, is a member of the G protein-coupled receptor (GPCR) family that has garnered attention due to its potential roles in various physiological processes and pathological conditions. Research indicates that GPR37L1 may be involved in regulating neuronal signaling and has implications in neurodegenerative diseases, such as Parkinson's disease. The receptor is primarily expressed in the brain, suggesting its relevance in central nervous system functions. Additionally, its interaction with endogenous ligands, including prosaptide, has been implicated in neuroprotective effects and modulating synaptic activity. Given the rising interest in GPCRs as drug targets, the study of GPR37L1, specifically through the development of recombinant proteins, is crucial for elucidating its biological functions and signaling pathways. Understanding the molecular mechanisms underlying GPR37L1's action can aid in identifying new therapeutic strategies for neurodegenerative disorders and other related diseases. Therefore, the production and characterization of GPR37L1 recombinant proteins are essential for advancing our knowledge of this receptor's role in health and disease, making it a significant focus of ongoing research efforts.
