Analytical Data
-
Gene name
GPR31
- Application
-
Alternative Names
GPR31; 12-(S-hydroxy-5.8.10.14-eicosatetraenoic acid receptor; 12-(S-HETE receptor; 12-HETER; G-protein coupled receptor 31; GPR31/12-HETER
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00270
-
Expression Region
1-319aa
-
AA Sequence
MPFPNCSAPSTVVATAVGVLLGLECGLGLLGNAVALWTFLFRVRVWKPYAVYLLNLALADLLLAACLPFLAAFYLSLQAWHLGRVGCWALRFLLDLSRSVGMAFLAAVALDRYLRVVHPRLKVNLLSPQAALGVSGLVWLLMVALTCPGLLISEAAQNSTRCHSFYSRADGSFSIIWQEALSCLQFVLPFGLIVFCNAGIIRALQKRLREPEKQPKLQRAQALVTLVVVLFALCFLPCFLARVLMHIFQNLGSCRALCAVAHTSDVTGSLTYLHSVLNPVVYCFSSPTFRSSYRRVFHTLRGKGQAAEPPDFNPRDSYS
-
Molecular Weight
61.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR31, also known as G protein-coupled receptor 31, has emerged as a significant subject of study within the field of molecular biology and pharmacology due to its potential role in various physiological processes and disease pathways. As a member of the GPR family, GPR31 functions as a receptor that interacts with different ligands, which may have implications in regulating immune responses, inflammation, and metabolic processes. Recent research highlights its involvement in modulating the activity of several signaling pathways, including those related to cell proliferation and apoptosis. The exploration of GPR31's functions is further underscored by its association with cardiovascular health and potential implications in neurodegenerative diseases. The investigation of recombinant GPR31 protein is critical, as it allows researchers to elucidate the receptor's structure, binding efficiencies, and subsequent signaling mechanisms. By generating and characterizing recombinant GPR31, scientists aim to develop new therapeutic strategies targeting this receptor, which could lead to innovative treatments for conditions such as heart disease and cancer. In this context, the study of GPR31 not only enhances our understanding of G protein-coupled receptor biology but also opens avenues for translational research aimed at improving human health.
