Analytical Data
-
Gene name
GPR30
- Application
-
Alternative Names
GPER1; CEPR; CMKRL2; DRY12; GPER; GPR30; G-protein coupled estrogen receptor 1; Chemoattractant receptor-like 2; Flow-induced endothelial G-protein coupled receptor 1; FEG-1; G protein-coupled estrogen receptor 1; G-protein coupled receptor 30
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99527
-
Expression Region
1-375aa
-
AA Sequence
MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV
-
Molecular Weight
68.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR30, also known as G protein-coupled receptor 30, is an estrogen receptor that has garnered significant attention in recent years due to its role in mediating estrogen's non-genomic effects. Unlike the traditional estrogen receptors (ERα and ERβ), GPR30 is primarily associated with rapid signaling pathways, influencing a variety of physiological processes such as cell proliferation, differentiation, and apoptosis. The discovery of GPR30 highlighted the complexity of estrogen signaling, suggesting that estrogen may exert its effects through multiple pathways. Research has indicated that GPR30 is involved in a range of conditions, including cardiovascular diseases, cancer, and neurological disorders, thus positioning it as a potential therapeutic target. Recent studies have focused on the development of recombinant GPR30 proteins to explore their structure-function relationships, signaling mechanisms, and interactions with ligands. These efforts aim to elucidate how GPR30 contributes to estrogen signaling and to identify novel strategies for modulating its activity in various diseases. Understanding GPR30's role at a molecular level could open new avenues for targeted therapies, providing insights into the regulation of estrogen-related biological processes and offering potential interventions for estrogen-dependent pathologies.
