Analytical Data
-
Gene name
GPR24
- Application
-
Alternative Names
MCHR1; GPR24; SLC1; Melanin-concentrating hormone receptor 1; MCH receptor 1; MCH-R1; MCHR-1; G-protein coupled receptor 24; MCH-1R; MCH1R; MCHR; SLC-1; Somatostatin receptor-like protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99705
-
Expression Region
1-422aa
-
AA Sequence
MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPDCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQLTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTLVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT
-
Molecular Weight
71.94 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR24, a member of the G protein-coupled receptor (GPCR) family, has gained attention in the fields of pharmacology and neuroscience due to its potential roles in various physiological processes and pathophysiological conditions. Initially, GPR24 was identified as an orphan receptor, meaning its endogenous ligand was unknown. However, subsequent research revealed that it is a receptor for neuropeptides, particularly those involved in the modulation of mood and anxiety, making GPR24 a promising target for therapeutic interventions in mental health disorders. Studies have shown that GPR24 is expressed in several brain regions, suggesting its involvement in central nervous system functions. Recent advancements in recombinant protein technology have enabled the production of GPR24 in heterologous systems, allowing for detailed functional characterization, ligand-binding studies, and structural analysis. By understanding the molecular mechanisms of GPR24 activation and signaling, researchers aim to explore its potential in drug development, particularly in designing novel treatments for depression and anxiety disorders. This research not only highlights the importance of GPR24 in neurobiology but also underscores the growing need for innovative therapeutic strategies targeting GPCRs, given their central role in numerous signal transduction pathways associated with a variety of diseases.
