Cat: PA2000-3876

Recombinant Human Smpdl3b Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Smpdl3b

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Smpdl3b;ASML3B;ASMLPD;Acid sphingomyelinase-like phosphodiesterase 3b

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q92485

  • Expression Region

    1-373aa

  • AA Sequence

    MRLLAWLIFLANWGGARAEPGKFWHIADLHLDPDYKVSKDPFQVCPSAGS QPVPDAGPWGDYLCDSPWALINSSIYAMKEIEPEPDFILWTGDDTPHVPD EKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDFHPKNQFPAGSNNI YNQIAELWKPWLSNESIALFKKGAFYCEKLPGPSGAGRIVVLNTNLYYTS NALTADMADPGQQFQWLEDVLTDASKAGDMVYIVGHVPPGFFEKTQNKAW FREGFNEKYLKVVRKHHRVIAGQFFGHHHTDSFRMLYDDAGVPISAMFIT PGVTPWKTTLPGVVNGANNPAIRVFEYDRATLSLKVRSPAEARGGGWEGL KCITTFPHSQLIHLPLTTEPQEG

  • Molecular Weight

    50.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Smpdl3b, or sphingomyelin phosphodiesterase-like 3B, is a recently identified protein that plays a crucial role in various cellular processes, particularly in the regulation of sphingolipid metabolism and signal transduction. Research has shown that Smpdl3b is involved in the hydrolysis of sphingomyelin, a vital component of cell membranes, leading to the production of biologically active lipids that influence cell growth, apoptosis, and inflammation. Its expression is observed in various tissues, and alterations in Smpdl3b levels have been linked to several pathological conditions, including cancer and neurodegenerative diseases like Alzheimer's. Consequently, the development of recombinant Smpdl3b protein has gained interest in the scientific community as it may provide insights into its biological functions and potential therapeutic applications. By studying the structure-function relationship of Smpdl3b, researchers aim to elucidate its role in disease mechanisms and explore its potential as a target for drug development. Additionally, recombinant Smpdl3b can serve as a valuable tool for biochemical assays and high-throughput screening processes, furthering our understanding of sphingolipid metabolism and its impact on human health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US