Analytical Data
-
Gene name
EML2
- Application
-
Alternative Names
EML2;EMAP2;EMAPL2;Echinoderm microtubule-associated Protein-like 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95834
-
Expression Region
1-418aa
-
AA Sequence
MSSFGAGKTKEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLEWVYGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTKEGKPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIE
-
Molecular Weight
61.8kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EML2 (Echinoderm Microtubule-Associated Protein Like 2) is a member of the EML protein family, which is implicated in microtubule organization and stability, playing an essential role in cellular processes such as mitosis and intracellular transport. Research on EML2 has gained traction due to its potential involvement in various diseases, including cancer and neurological disorders. The protein's function in the cytoskeleton suggests that it may influence cell shape, division, and motility, making it a significant target for understanding cellular dynamics and disease progression. EML2's interaction with other cellular components, including its binding to tubulin and involvement in microtubule stability, highlights its importance in maintaining proper cellular architecture. Recent studies have focused on characterizing its structural properties and elucidating the molecular mechanisms governing its activity. Recombinant EML2 proteins have been produced to facilitate in-depth biochemical analyses, including assays for binding specificity and functional assessments in cell culture models. By advancing our understanding of EML2's role in cellular processes, researchers aim to uncover potential therapeutic strategies that could leverage its dysregulation in disease contexts, ultimately contributing to the development of targeted interventions in oncology and neurobiology. The comprehensive study of EML2 promises not only to clarify its intrinsic biological functions but also to provide insights into the broader implications of microtubule-associated proteins in health and disease.











