Analytical Data
-
Gene name
PPAN
- Application
-
Alternative Names
PPAN；BXDC3；SSF1；Suppressor of SWI4 1 homolog
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NQ55
-
Expression Region
1-473aa
-
AA Sequence
MGQSGRSRHQKRARAQAQLRNLEAYAANPHSFVFTRGCTGRNIRQLSLDVRRVMEPLTASRLQVRKKNSLKDCVAVAGPLGVTHFLILSKTETNVYFKLMRLPGGPTLTFQVKKYSLVRDVVSSLRRHRMHEQQFAHPPLLVLNSFGPHGMHVKLMATMFQNLFPSINVHKVNLNTIKRCLLIDYNPDSQELDFRHYSIKVVPVGASRGMKKLLQEKFPNMSRLQDISELLATGAGLSESEAEPDGDHNITELPQAVAGRGNMRAQQSAVRLTEIGPRMTLQLIKVQEGVGEGKVMFHSFVSKTEEELQAILEAKEKKLRLKAQRQAQQAQNVQRKQEQREAHRKKSLEGMKKARVGGSDEEASGIPSRTASLELGEDDDEQEDDDIEYFCQAVGEAPSEDLFPEAKQKRLAKSPGRKRKRWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGGRGRGRGRPGKRVA
-
Molecular Weight
55.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPAN (Poly(A) Polymerase and Nuclear RNA Binding Protein) is a multifunctional protein that plays a critical role in various cellular processes, including RNA metabolism, gene expression regulation, and cellular signaling. It is involved in the polyadenylation of mRNA, a vital step in the maturation and stabilization of messenger RNA transcripts. Understanding the structure and function of PPAN is essential as it can provide insights into mechanisms of gene regulation and the potential implications of dysregulation in diseases, including cancer and neurodegenerative disorders. Recent studies have highlighted the importance of PPAN in the formation of ribonucleoprotein complexes and its interactions with other RNA-binding proteins. Furthermore, the research on PPAN is gaining momentum due to its potential as a therapeutic target. Investigating the recombinant expression of PPAN allows for the characterization of its biochemical properties, interaction with nucleic acids, and identification of post-translational modifications that may affect its function. The development of recombinant PPAN proteins paves the way for high-throughput screening of small molecules that could modulate its activity, offering new avenues for drug discovery and therapeutic interventions. Thus, ongoing research aims to elucidate the precise roles of PPAN in cellular processes, and its implications for human health, making it a significant focus in molecular biology and biomedicine.
