Analytical Data
-
Gene name
MMP16
- Application
-
Alternative Names
MMP16；C8orf57；MMPX2；Matrix metalloProteinase-16
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51512
-
Expression Region
1-607aa
-
AA Sequence
MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPTRPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRVKEGHSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCKRSMQEWV
-
Molecular Weight
69.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MMP16, or Matrix Metalloproteinase 16, is a member of the matrix metalloproteinase family, which is known for its role in the degradation of extracellular matrix components. Research into MMP16 has gained attention due to its involvement in various physiological and pathological processes, particularly in tissue remodeling, angiogenesis, and the progression of cancers, such as breast and lung cancer. Unlike other MMPs, MMP16 functions as a membrane-type matrix metalloproteinase (MT-MMP), indicating that it is tethered to the cell membrane and capable of interacting directly with substrates in the microenvironment. This localization allows MMP16 to play a critical role in pericellular proteolysis, facilitating cellular migration and invasion, which are key components in cancer metastasis. Additionally, MMP16 has been implicated in inflammatory diseases and tissue repair, highlighting its potential as a therapeutic target. Ongoing studies aim to elucidate its specific biological functions, regulatory mechanisms, and the interactions between MMP16 and other matrix components, with the goal of better understanding its contributions to both normal physiology and disease states. The development of recombinant MMP16 protein has facilitated these studies, enabling researchers to investigate its enzymatic activity, structure-function relationships, and effects on cellular behaviors, thereby paving the way for novel therapeutic interventions in conditions characterized by abnormal matrix remodeling or dysregulated cellular interactions.
