Cat: PA2000-3846

Recombinant Human NT5C1A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NT5C1A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NT5C1A;Cytosolic 5'-nucleotidase 1A

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BXI3

  • Expression Region

    1-368aa

  • AA Sequence

    MEPGQPREPQEPREPGPGAETAAAPVWEEAKIFYDNLAPKKKPKSPKPQN AVTIAVSSRALFRMDEEQQIYTEQGVEEYVRYQLEHENEPFSPGPAFPFV KALEAVNRRLRELYPDSEDVFDIVLMTNNHAQVGVRLINSINHYDLFIER FCMTGGNSPICYLKAYHTNLYLSADAEKVREAIDEGIAAATIFSPSRDVV VSQSQLRVAFDGDAVLFSDESERIVKAHGLDRFFEHEKAHENKPLAQGPL KGFLEALGRLQKKFYSKGLRLECPIRTYLVTARSAASSGARALKTLRSWG LETDEALFLAGAPKGPLLEKIRPHIFFDDQMFHVAGAQEMGTVAAHVPYG VAQTPRRTAPAKQAPSAQ

  • Molecular Weight

    43 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NT5C1A, or cytosolic 5'-nucleotidase 1A, is an enzyme that plays a critical role in nucleotide metabolism by hydrolyzing nucleotides to produce nucleosides, which are vital for various cellular functions such as DNA and RNA synthesis. Research on NT5C1A has gained significant attention due to its implications in cancer biology, where it is associated with tumor progression and poor patient prognosis. Elevated levels of NT5C1A have been observed in several cancer types, suggesting that it may contribute to the tumor microenvironment by regulating nucleotide pools and influencing cellular signaling pathways. Furthermore, NT5C1A's ability to modulate the immune response by affecting adenosine levels has positioned it as a potential target for immunotherapy. Understanding the biochemistry of NT5C1A through recombinant protein studies can provide insights into its structure-function relationships, enzymatic properties, and regulatory mechanisms. This knowledge could pave the way for the development of novel therapeutic strategies aimed at inhibiting NT5C1A activity, thereby enhancing anti-tumor immunity and improving treatment outcomes for cancer patients. As such, NT5C1A represents a promising candidate for further investigation in both basic research and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US