Analytical Data
-
Gene name
GPR110
- Application
-
Alternative Names
G protein coupled receptor 110; G protein coupled receptor KPG_012; G protein coupled receptor PGR19; G-protein coupled receptor KPG_012; G-protein coupled receptor PGR19; GP110_HUMAN; GPR110; HGPCR36; KPG_012; PGR19; Probable G protein coupled receptor 110; Probable G-protein coupled receptor 110
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5T601
-
Expression Region
1-218aa
-
AA Sequence
MKVGVLWLISFFTFTDGHGGFLGKNDGIKTKKELIVNKKKHLGPVEEYQLLLQVTYRDSKEKRDLRNFLKLLKPPLLWSHGLIRIIRAKATTDCNSLNGVLQCTCEDSYTWFPPSCLDPQNCYLHTAGALPSCECHLNNLSQSVNFCERTKIWGTFKINERFTNDLLNSSSAIYSKYANGIEIQLKKAYERIQGFESVQVTQFRMSLLSPKLECNGTI
-
Molecular Weight
51.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR110, also known as ADGRF1, is a member of the adhesion G protein-coupled receptor (GPCR) family, which plays a crucial role in various physiological processes, including cell adhesion, migration, and signaling pathways. The significance of GPR110 has been increasingly recognized in recent years, particularly due to its involvement in various pathological conditions such as cancer, neurodegenerative diseases, and obesity. The development of recombinant GPR110 protein has become a focal point for researchers aiming to better understand its structure-function relationships and the underlying mechanisms of its signaling pathways. By producing and characterizing this protein, scientists aim to explore its ligand interactions, potential as a therapeutic target, and its broader implications in human health. Furthermore, studying GPR110 can provide insights into the intricacies of GPCR signaling and the role of adhesion receptors in cellular communication. The advancements in recombinant protein technology facilitate the investigation of GPR110's functional properties, paving the way for potential drug discovery and therapeutic interventions aimed at conditions linked to GPR110 dysregulation.
