Analytical Data
-
Gene name
GOLGB1
- Application
-
Alternative Names
372 kDa Golgi complex associated protein; 372 kDa Golgi complex-associated protein; GCP; GCP372; Giantin; GOGB1_HUMAN; GOLGB1; Golgi autoantigen golgin subfamily a member 1; Golgi autoantigen golgin subfamily b macrogolgin (with transmembrane signal) 1 ; Golgi autoantigen. golgin subfamily b. macrogolgin 1; Golgi complex associated protein 372kDa; Golgi complex-associated protein 372kDa; Golgin B1; Golgin B1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14789
-
Expression Region
3-91aa
-
AA Sequence
SRLSGLANVVLHELSGDDDTDQNMRAPLDPELHQESDMEFNNTTQEDVQERLAYAEQLVVELKDIIRQKDVQLQQKDEALQEERKAADN
-
Molecular Weight
35.53 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GOLGB1, a member of the golgin family of proteins, plays a crucial role in the Golgi apparatus, particularly in maintaining its structure and function. This protein is involved in various cellular processes, including vesicle trafficking, sorting, and transport of proteins and lipids within the cell. Research into GOLGB1 has gained momentum due to its implications in multiple diseases, including cancer and neurodegenerative disorders. Understanding the mechanisms by which GOLGB1 operates can provide insights into cellular organization and function, as well as potential therapeutic targets for intervening in disease progression. Moreover, GOLGB1's interactions with other cellular components contribute to the efficient processing and modification of glycoproteins, which are essential for proper cell signaling and communication. The recombinant production of GOLGB1 enables detailed studies of its structural and functional properties, facilitating the exploration of its roles in health and disease contexts. Investigating the recombinant protein's stability, interaction networks, and potential as a drug target is vital for developing therapies that can modulate its activity. Overall, GOLGB1 stands out as a significant protein in cellular biology, making it a focal point for research aimed at elucidating its function and potential clinical applications.
