Cat: PA2000-3827

Recombinant E.coli HDT2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HDT2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HDT2;HD2;HD2B;HDA4;Histone deacetylase HDT2

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q56WH4

  • Expression Region

    1-306aa

  • AA Sequence

    MEFWGVAVTPKNATKVTPEEDSLVHISQASLDCTVKSGESVVLSVTVGGA KLVIGTLSQDKFPQISFDLVFDKEFELSHSGTKANVHFIGYKSPNIEQDD FTSSDDEDVPEAVPAPAPTAVTANGNAGAAVVKADTKPKAKPAEVKPAEE KPESDEEDESDDEDESEEDDDSEKGMDVDEDDSDDDEEEDSEDEEEEETP KKPEPINKKRPNESVSKTPVSGKKAKPAAAPASTPQKTEEKKKGGHTATP HPAKKGGKSPVNANQSPKSGGQSSGGNNNKKPFNSGKQFGGSNNKGSNKG KGKGRA

  • Molecular Weight

    34 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HDT2, a member of the histone deacetylase (HDAC) family, has garnered significant attention due to its role in regulating gene expression and its implications in various diseases, particularly cancer. Histone deacetylases are crucial for maintaining epigenetic control of chromatin structure, influencing transcriptional activity and cellular processes such as differentiation, proliferation, and apoptosis. The deregulation of HDACs, including HDT2, has been associated with tumorigenesis and other pathological conditions. Consequently, HDT2 serves as a potential therapeutic target, with studies focusing on its structural characterization and functional analysis to develop specific inhibitors. By comprehending the mechanisms through which HDT2 modulates genetic regulation, researchers aim to elucidate its contribution to disease progression and explore its utilization in innovative treatment strategies. The recombinant protein production of HDT2 enables comprehensive biochemical and biophysical studies, paving the way for new insights into its enzymatic activities and inhibition. Enhanced understanding of HDT2's function in cellular pathways may reveal novel diagnostic and therapeutic avenues for HDAC-inhibitor-based cancer therapies and other diseases linked to epigenetic dysregulation.  

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US