Analytical Data
-
Gene name
FABP2
- Application
-
Alternative Names
FABP2；FABPI;Fatty acid-binding Protein. intestinal
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P12104
-
Expression Region
2-132aa
-
AA Sequence
AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD
-
Molecular Weight
17.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Fatty acid binding protein 2 (FABP2) is a crucial intracellular protein that plays a significant role in lipid metabolism and the regulation of fatty acid homeostasis. It primarily facilitates the transportation and binding of long-chain fatty acids within cells, influencing various metabolic pathways and signaling processes. Research on FABP2 has gained momentum due to its implications in metabolic diseases, including obesity, type 2 diabetes, and cardiovascular disorders. Variations in FABP2 expression and function have been linked to insulin resistance and altered lipid profiles, making it a potential biomarker and therapeutic target. The recombinant production of FABP2 proteins allows for detailed structural and functional studies, enabling researchers to examine its binding properties, interactions with fatty acids, and effects on metabolic regulation. Furthermore, recombinant FABP2 can be used in high-throughput screening for small molecules that modulate its activity, paving the way for novel interventions in metabolic disorders. Understanding the mechanistic role of FABP2 in cellular metabolism could lead to breakthroughs in developing therapeutic strategies aimed at combating lipid-related diseases.
