Cat: PA1000-1072

Recombinant Human FABP2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FABP2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FABP2;FABPI;Fatty acid-binding Protein. intestinal

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P12104

  • Expression Region

    2-132aa

  • AA Sequence

    AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD

  • Molecular Weight

    17.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Fatty acid binding protein 2 (FABP2) is a crucial intracellular protein that plays a significant role in lipid metabolism and the regulation of fatty acid homeostasis. It primarily facilitates the transportation and binding of long-chain fatty acids within cells, influencing various metabolic pathways and signaling processes. Research on FABP2 has gained momentum due to its implications in metabolic diseases, including obesity, type 2 diabetes, and cardiovascular disorders. Variations in FABP2 expression and function have been linked to insulin resistance and altered lipid profiles, making it a potential biomarker and therapeutic target. The recombinant production of FABP2 proteins allows for detailed structural and functional studies, enabling researchers to examine its binding properties, interactions with fatty acids, and effects on metabolic regulation. Furthermore, recombinant FABP2 can be used in high-throughput screening for small molecules that modulate its activity, paving the way for novel interventions in metabolic disorders. Understanding the mechanistic role of FABP2 in cellular metabolism could lead to breakthroughs in developing therapeutic strategies aimed at combating lipid-related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US