Cat: PA1000-1058

Recombinant Human EXOSC3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EXOSC3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    EXOSC3;RRP40;Exosome complex component RRP40

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NQT5

  • Expression Region

    1-275aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMAEPASVAAESLAGSRARAARTVLGQV VLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPGLRRCGDR LLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGD IFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPE MVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPL EIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES

  • Molecular Weight

    32 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

EXOSC3 is a key component of the exosome complex, which is responsible for the degradation of RNA in eukaryotic cells. Its role extends beyond RNA processing; it is involved in various cellular functions, including the regulation of gene expression and the response to stress. Mutations in the EXOSC3 gene have been linked to specific neurodegenerative disorders, particularly in the context of conditions like telomere-associated dyskeratosis congenita and spinal muscular atrophy. The study of EXOSC3 and its associated pathways has garnered significant attention in molecular biology and genetics, as understanding its function and mechanisms can provide insights into the fundamental processes of RNA metabolism and the pathogenesis of related diseases. Recent advances in recombinant protein technology have facilitated the production of EXOSC3 in vitro, allowing researchers to investigate its structural and functional properties. This research is crucial for unveiling the molecular basis of the associated disorders and may lead to the development of targeted therapies. Overall, studying EXOSC3 not only enhances our understanding of RNA decay pathways but also opens new avenues for addressing genetic diseases linked to its dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US