Analytical Data
-
Gene name
SERPINA3-2
- Application
-
Alternative Names
SERPINA3-2;HTJ1;DnaJ homolog subfamily C member 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A2I7M9
-
Expression Region
25-411aa
-
AA Sequence
LPENVVVKDQHRRVDGHTLASSNTDFAFSLYKQLALKNPNKNVILSPLSVSIALAFLSLGARGSTLTEILEGLKFNLTEIQEKEIHHSFQHLLQALNQPSNQLQLSVGNAMFVQEELKLLDKFIEDAQVLYSSEAFPTNFRDSEAARSLINDYVKNKTQGKIEELFKYLSPRTELVLVNYIYFKAQWKTPFDPKHTEQAEFHVSDNKTVEVPMMTLDLETPYFRDEELGCTLVELTYTSNDSALFILPDEGKMRDLEAKLTPETLTRWRNSLQPRRIHELYLPKFSIKSNYELNDILSQLGIRKIFANADLSGITGTADLVVSQVVHGAALDVDEEGTEGVAATGIGIERTFLRIIVRVNRPFLIAVVLKDTQSIIFLGKVTNPSEA
-
Molecular Weight
45.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SERPINA3-2, also known as alpha-1-antichymotrypsin (ACT), is a member of the serpin superfamily of serine protease inhibitors, playing a critical role in regulating proteolytic activity in various biological processes. Its expression is predominantly found in the liver, and it is secreted into the bloodstream, where it functions to inhibit a range of proteases, thus protecting tissues from damage caused by inflammatory processes. Research indicates that altered levels of SERPINA3-2 are associated with various diseases, including chronic obstructive pulmonary disease (COPD), liver cirrhosis, and certain cancers, making it a crucial target for therapeutic intervention. The protein has also been shown to have immunomodulatory properties, influencing immune responses and inflammatory pathways. Due to its significant role in disease pathology, the production of recombinant SERPINA3-2 protein has garnered attention for its potential use in both diagnostic and therapeutic applications. Studies involving the recombinant protein can provide insights into its structure-function relationship, paving the way for the development of novel treatments aimed at modulating its activity in disease contexts. Understanding the molecular mechanism underlying SERPINA3-2's protective functions could lead to innovative strategies to mitigate tissue damage and inflammation in various disorders, underscoring the importance of this protein in biomedical research.











