Cat: PA2000-3809

Recombinant Human mtb12 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    mtb12

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    mtb12;cfp2;Low molecular weight antigen MTB12

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P9WIN7

  • Expression Region

    1-168aa

  • AA Sequence

    MKMVKSIAAGLTAAAAIGAAAAGVTSIMAGGPVVYQMQPVVFGAPLPLDPASAPDVPTAAQLTSLLNSLADPNVSFANKGSLVEGGIGGTEARIADHKLKKAAEHGDLPLSFSVTNIQPAAAGSATADVSVSGPKLSSPVTQNVTFVNQGGWMLSRASAMELLQAAGN

  • Molecular Weight

    16.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MTB12 recombinant protein, derived from the MTB family, has garnered significant attention in the field of biochemistry and molecular biology due to its potential applications in various scientific and medical domains. Initially identified for its role in specific biological pathways, MTB12 has been implicated in processes such as protein folding, cellular stress responses, and interaction with other biomolecules. The recombinant production of MTB12 enables researchers to study its structure-function relationship in vitro, facilitating investigations into its mechanisms of action and potential therapeutic applications. Furthermore, the development of MTB12 as a recombinant protein allows for the exploration of its use as a biomarker in disease diagnosis and prognosis, as well as its potential in drug discovery and development. Advances in recombinant DNA technology, including the use of expression systems such as bacteria, yeast, or mammalian cells, have made it feasible to produce MTB12 in large quantities with high purity, further enhancing its research viability. As the scientific community continues to unveil the complexities of MTB12's biological functions, understanding its role may lead to innovative solutions for medical challenges, particularly in the context of diseases where protein misfolding or cellular stress plays a crucial role. Thus, MTB12 serves as a promising candidate for further exploration, emphasizing the need for comprehensive studies that illuminate its properties and applications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US