Analytical Data
-
Gene name
TMPRSS4
- Application
-
Alternative Names
TMPRSS4；TMPRSS3；Transmembrane protease serine 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NRS4
-
Expression Region
54-437aa
-
AA Sequence
KVILDKYYFLCGQPLHFIPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETACRQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWIYNVWKAEL
-
Molecular Weight
49.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMPRSS4 (Transmembrane Protease, Serine 4) is a serine protease that has garnered attention due to its significant role in various biological processes, including cell signaling, migration, and tumor progression. It is primarily expressed in epithelial tissues and has been implicated in the activation of viral proteins, which makes it a potential target for antiviral strategies. Researchers have increasingly focused on the characterization and expression of recombinant TMPRSS4 proteins to better understand their structure, function, and interactions with other cellular components. The study of TMPRSS4 is particularly relevant in the context of viral infections, such as those caused by coronaviruses, as it facilitates the entry of viruses into host cells. By producing and studying recombinant TMPRSS4 proteins, scientists aim to elucidate the mechanisms by which this protease influences viral pathogenesis and to explore its potential as a therapeutic target. The insights gained from these studies may pave the way for novel approaches in treating viral infections and related diseases, highlighting the importance of TMPRSS4 in both basic and applied biomedical research.
