Analytical Data
-
Gene name
TMPRSS2
- Application
-
Alternative Names
TMPRSS2；PRSS10；Transmembrane protease serine 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15393
-
Expression Region
383-492aa
-
AA Sequence
GWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQG NVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTD WIYRQMRADG
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMPRSS2 (transmembrane protease, serine 2) is a type II transmembrane serine protease that plays a crucial role in various physiological processes, including cell signaling, tissue remodeling, and immune response. Its significant relevance came to light during the COVID-19 pandemic, as it was identified as a key host factor facilitating the entry of SARS-CoV-2 into human cells. TMPRSS2 activates the viral spike protein through proteolytic cleavage, which is a critical step for the virus to fuse with host cell membranes. This connection between TMPRSS2 and viral entry has spurred intense research interest, especially regarding its potential as a therapeutic target. Studies have focused on characterizing the expression patterns of TMPRSS2 in different tissues and its regulation by androgen signaling, as well as exploring small molecule inhibitors that could block its activity and potentially mitigate viral infection. Furthermore, the development of recombinant TMPRSS2 proteins has enabled researchers to better understand its enzymatic properties, interactions with viral proteins, and the overall mechanism of viral entry, paving the way for novel therapeutic strategies against not only COVID-19 but also other viral infections that utilize similar entry mechanisms. Understanding the structure and function of TMPRSS2 is thus crucial for developing effective antiviral treatments and enhancing our overall knowledge of viral pathogenesis.
