Cat: PA1000-1050

Recombinant Human ESM1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ESM1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ESM1;Endothelial cell-specific molecule 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NQ30

  • Expression Region

    20-184aa

  • AA Sequence

    WSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTV SGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQS GICDRGTGCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKEN AAGSPVMRKWLNPRTRHHHHHH

  • Molecular Weight

    19 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ESM1, or Endothelial Cell-Specific Molecule 1, is a glycoprotein predominantly expressed in endothelial cells, particularly in the vascular endothelium. It plays a crucial role in various physiological processes, including angiogenesis, vascular permeability, and inflammation. Recent studies have linked ESM1 to several pathological conditions, such as cardiovascular diseases, tumors, and chronic inflammatory diseases. Researchers are increasingly interested in ESM1 as a potential biomarker for disease progression and therapeutic target due to its significant involvement in endothelial function and disease mechanisms. The recombinant protein form of ESM1 provides an invaluable tool for studying its biological functions and interactions in vitro and in vivo. By utilizing ESM1 recombinant proteins, scientists aim to elucidate its role in endothelial cell signaling, immune response modulation, and its potential as a target for drug discovery. Overall, the study of ESM1 and its recombinant proteins promises to enhance our understanding of endothelial biology and offer insights into innovative treatment strategies for various vascular-related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US