Analytical Data
-
Gene name
EPO
- Application
-
Alternative Names
EPO;Erythropoietin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01588
-
Expression Region
28-193aa
-
AA Sequence
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA WKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVS GLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLR GKLKLYTGEACRTGDR
-
Molecular Weight
18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Recombinant erythropoietin (EPO) is a glycoprotein hormone that plays a critical role in erythropoiesis, the process of red blood cell production. Initially identified in the late 20th century, EPO was found to be a key regulator of red blood cell formation in response to hypoxic conditions. The clinical significance of EPO became apparent with the recognition of its potential for treating anemia, particularly in patients undergoing chemotherapy, those with chronic kidney disease, and individuals with various medical conditions leading to reduced red blood cell counts. The advent of recombinant DNA technology facilitated the production of EPO in laboratory settings, leading to the development of biosynthetic forms of the hormone that could be administered therapeutically. This breakthrough allowed for greater availability and purity of EPO, overcoming the limitations of traditional extraction from human or animal sources. Ongoing research focuses on optimizing EPO formulations, understanding its broader biological effects, and minimizing potential side effects, including excessive polycythemia or cardiovascular complications. Additionally, the use of EPO doping in sports has raised ethical concerns, prompting investigations into regulatory measures and detection methods. Overall, recombinant EPO has transformed the management of anemia and continues to be a subject of extensive research aimed at improving its therapeutic applications and ensuring safe administration.











