Cat: PA1000-1048

Recombinant Human EPO Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EPO

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    EPO;Erythropoietin

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P01588

  • Expression Region

    28-193aa

  • AA Sequence

    APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA WKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVS GLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLR GKLKLYTGEACRTGDR

  • Molecular Weight

    18 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Recombinant erythropoietin (EPO) is a glycoprotein hormone that plays a critical role in erythropoiesis, the process of red blood cell production. Initially identified in the late 20th century, EPO was found to be a key regulator of red blood cell formation in response to hypoxic conditions. The clinical significance of EPO became apparent with the recognition of its potential for treating anemia, particularly in patients undergoing chemotherapy, those with chronic kidney disease, and individuals with various medical conditions leading to reduced red blood cell counts. The advent of recombinant DNA technology facilitated the production of EPO in laboratory settings, leading to the development of biosynthetic forms of the hormone that could be administered therapeutically. This breakthrough allowed for greater availability and purity of EPO, overcoming the limitations of traditional extraction from human or animal sources. Ongoing research focuses on optimizing EPO formulations, understanding its broader biological effects, and minimizing potential side effects, including excessive polycythemia or cardiovascular complications. Additionally, the use of EPO doping in sports has raised ethical concerns, prompting investigations into regulatory measures and detection methods. Overall, recombinant EPO has transformed the management of anemia and continues to be a subject of extensive research aimed at improving its therapeutic applications and ensuring safe administration.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US