Cat: PA1000-1024

Recombinant Human ENTPD6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ENTPD6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ENTPD6;CD39L2;IL6ST2;Ectonucleoside triphosphate diphosphohydrolase 6

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O75354

  • Expression Region

    61-484aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSKWHRATATQAFFSITRAAPGARWGQQA HSPLGTAADGHEVFYGIMFDAGSTGTRVHVFQFTRPPRETPTLTHETFKA LKPGLSAYADDVEKSAQGIRELLDVAKQDIPFDFWKATPLVLKATAGLRL LPGEKAQKLLQKVKEVFKASPFLVGDDCVSIMNGTDEGVSAWITINFLTG SLKTPGGSSVGMLDLGGGSTQIAFLPRVEGTLQASPPGYLTALRMFNRTY KLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSPSFKGEWEHA EVTYRVSGQKAAASLHELCAARVSEVLQNRVHRTEEVKHVDFYAFSYYYD LAAGVGLIDAEKGGSLVVGDFEIAAKYVCRTLETQPQSSPFSCMDLTYVS LLLQEFGFPRSKVLKLTRKIDNVETSWALGAIFHYIDSLNRQKSPAS

  • Molecular Weight

    49 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ENTPD6, or ecto-nucleotide triphosphate diphosphohydrolase 6, is an enzyme belonging to the family of ecto-nucleotide triphosphate diphosphohydrolases that hydrolyzes nucleotide triphosphates and diphosphates on the extracellular surface of cells. Its study has garnered attention due to its potential roles in various physiological and pathological processes, including cell signaling, immune response, and modulation of the tumor microenvironment. Research has highlighted that ENTPD6 participates in the regulation of purinergic signaling, which is critical for cellular communication and has implications in diseases such as cancer, where altered nucleotide metabolism may affect tumor growth and immune evasion. Additionally, ENTPD6 is implicated in inflammatory conditions and has been identified as a potential therapeutic target. Understanding the biochemical properties and functions of ENTPD6, particularly through the development and characterization of recombinant protein, provides valuable insights into its mechanisms of action, potential inhibitors, and its role in disease pathology. This research not only enhances our understanding of purinergic signaling but also aims to explore the enzyme’s applicability in therapeutic contexts, offering new avenues for drug development and treatment strategies. The generation of recombinant ENTPD6 protein enables detailed studies on its enzymatic activity, substrate specificity, and interactions with other cellular components, paving the way for future investigations that could lead to novel therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US