Analytical Data
-
Gene name
LCR83
- Application
-
Alternative Names
LCR83；Putative defensin-like Protein 70
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P82792
-
Expression Region
28-82aa
-
AA Sequence
NFASGEASSQLCFNPCTPQLGNNECNTICMNKKYKEGSCVGFGIPPTSKYCCCKT
-
Molecular Weight
32.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LCR83 is a recombinant protein derived from the LCR (liver cancer-related) gene, which has gained significant attention in the field of molecular biology and cancer research. The understanding of LCR proteins has evolved due to their potential roles in various cellular processes, including cell proliferation, apoptosis, and differentiation, particularly in hepatocellular carcinoma (HCC). Research indicates that LCR proteins may interact with key signaling pathways, thereby influencing tumorigenesis and cancer progression. The generation of LCR83 as a recombinant protein allows for in-depth studies of its biochemical properties and biological functions. Scientists aim to elucidate the mechanisms by which LCR83 contributes to liver cancer development, as well as its potential as a biomarker for early detection and a therapeutic target. Ongoing investigations focus on assessing its interactions with other molecules and examining its effects on tumor cell behavior. The insights gained from LCR83 research could pave the way for novel therapeutic strategies, ultimately improving patient outcomes in liver cancer treatment and management. Understanding LCR83’s complex role in cancer biology may also enhance our overall comprehension of tumorigenesis and lead to advancements in precision medicine. As such, LCR83 represents not only a vital subject of study within cancer biology but also a promising candidate for future therapeutic innovations.
