Analytical Data
-
Gene name
ENSA
- Application
-
Alternative Names
ENSA;Alpha-endosulfine
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43768
-
Expression Region
1-121aa
-
AA Sequence
MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE
-
Molecular Weight
40.4kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ENSA (Endothelial Nitric Oxide Synthase Activator) is a crucial regulatory protein involved in the modulation of nitric oxide (NO) synthesis, primarily within endothelial cells. Nitric oxide plays a significant role in vascular homeostasis, influencing processes such as vasodilation, blood flow regulation, and platelet aggregation. The study of ENSA and its recombinant protein is vital for understanding the mechanisms underlying cardiovascular diseases, including hypertension and atherosclerosis, where NO signaling is often disrupted. Additionally, ENSA has emerged as a potential therapeutic target due to its involvement in various pathological conditions, including diabetes and inflammatory diseases. By investigating the structure and function of recombinant ENSA, researchers aim to elucidate its role in NO production and explore its potential as a biomarker or treatment option. The developing understanding of ENSA's interactions and regulatory networks can lead to novel insights into endothelial function and the development of targeted therapies to improve vascular health.











