Analytical Data
-
Gene name
ENOPH1
- Application
-
Alternative Names
ENOPH1；MASA;Enolase-phosphatase E1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UHY7
-
Expression Region
1-261aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMVVLSVPAEVTVILLDIEGTTTPIAFVKDI LFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASG NGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAE FFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHF DTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVV VRPGNAGLTDDEKTYYSLITSFSELYLPSST
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ENOPH1, or Enolase Phosphatase 1, is an enzyme that belongs to the family of lyases, specifically involved in the hydrolysis of phosphoenolpyruvate and other phosphoesters. Its biological significance has garnered increasing attention due to its role in various physiological and pathological processes. ENOPH1 is involved in metabolic pathways and has been linked to cancer progression, cardiovascular diseases, and neurological disorders. Research has demonstrated that this enzyme influences cellular energy metabolism and signaling pathways, highlighting its potential as a therapeutic target. The production of recombinant ENOPH1 protein has become vital for further studies, enabling the exploration of its enzymatic mechanisms and interactions with other cellular components. By using recombinant DNA technology, scientists can produce ENOPH1 in controlled laboratory settings, facilitating detailed biochemical analyses and drug development. Understanding the structure and function of ENOPH1 can pave the way for novel approaches in treating diseases associated with its dysregulation, thus establishing it as a key player in both basic and applied biomedical research.
