Analytical Data
-
Gene name
GNPDA2
- Application
-
Alternative Names
GlcN6P deaminase 2; Glucosamine 6 phosphate deaminase 2; Glucosamine 6 phosphate isomerase 2; Glucosamine 6 phosphate isomerase SB52; Glucosamine-6-phosphate deaminase 2; Glucosamine-6-phosphate isomerase 2; Glucosamine-6-phosphate isomerase SB52; GNP2; GNPDA 2; Gnpda2; GNPI2_HUMAN; SB52
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TDQ7
-
Expression Region
1-276aa
-
AA Sequence
MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGGIDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN
-
Molecular Weight
57.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GNPDA2 (Glucosamine-6-phosphate Deaminase 2) is an enzyme that plays a crucial role in amino sugar metabolism and is implicated in various physiological processes. Research on GNPDA2 has gained traction due to its association with several metabolic disorders, including obesity and type 2 diabetes. The enzyme contributes to the regulation of cellular glucose levels and the metabolic pathway involved in glucosamine conversion, influencing insulin signaling and energy homeostasis. Recent studies have highlighted GNPDA2 as a potential biomarker for metabolic diseases, offering insights into its role in neuropathic pain and cognitive functions. Moreover, genetic variants in the GNPDA2 gene have been linked to an increased risk of developing obesity and related metabolic syndromes, prompting interest in its molecular mechanisms. The production of recombinant GNPDA2 protein allows for the investigation of its enzymatic activity and interaction with various substrates, providing valuable information for designing targeted therapies. Understanding the structure and function of GNPDA2 through recombinant approaches facilitates the exploration of its therapeutic potential, particularly in metabolic diseases, and paves the way for further research into its broader biological implications. This growing body of research underscores the importance of GNPDA2 in health and disease, prompting ongoing efforts to elucidate its molecular pathways and develop innovative therapeutic strategies.
