Analytical Data
-
Gene name
ZG16B
- Application
-
Alternative Names
ZG16B；PAUF；Pancreatic adenocarcinoma up-regulated factor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96DA0
-
Expression Region
53-208aa
-
AA Sequence
GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
-
Molecular Weight
20.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZG16B, a member of the gelatinase family, has garnered significant interest in the field of molecular biology and immunology due to its role in the human immune response and its potential implications in various diseases. Discovered as a secreted protein predominantly expressed in the pancreas and intestines, ZG16B is involved in the innate immune system, particularly in the recognition of microbial pathogens. It functions by binding to glycan molecules, which are present on the surfaces of various microorganisms, including bacteria and fungi. This binding ability suggests that ZG16B may play a crucial role in modulating inflammatory responses and maintaining gut homeostasis. Recent studies have highlighted its significance in conditions such as inflammatory bowel disease (IBD) and certain cancers, where altered expression levels of ZG16B have been observed. Furthermore, researchers are exploring its potential as a biomarker for early diagnosis and as a therapeutic target due to its regulatory functions in immune cell signaling pathways. As the understanding of ZG16B continues to evolve, its role in host-pathogen interactions and the overall immune landscape presents promising avenues for future research, particularly in developing innovative strategies for disease prevention and treatment.
