Cat: PA1000-9607

Recombinant Human ZG16B Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ZG16B

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ZG16B;PAUF;Pancreatic adenocarcinoma up-regulated factor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96DA0

  • Expression Region

    53-208aa

  • AA Sequence

    GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR

  • Molecular Weight

    20.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ZG16B, a member of the gelatinase family, has garnered significant interest in the field of molecular biology and immunology due to its role in the human immune response and its potential implications in various diseases. Discovered as a secreted protein predominantly expressed in the pancreas and intestines, ZG16B is involved in the innate immune system, particularly in the recognition of microbial pathogens. It functions by binding to glycan molecules, which are present on the surfaces of various microorganisms, including bacteria and fungi. This binding ability suggests that ZG16B may play a crucial role in modulating inflammatory responses and maintaining gut homeostasis. Recent studies have highlighted its significance in conditions such as inflammatory bowel disease (IBD) and certain cancers, where altered expression levels of ZG16B have been observed. Furthermore, researchers are exploring its potential as a biomarker for early diagnosis and as a therapeutic target due to its regulatory functions in immune cell signaling pathways. As the understanding of ZG16B continues to evolve, its role in host-pathogen interactions and the overall immune landscape presents promising avenues for future research, particularly in developing innovative strategies for disease prevention and treatment.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US