Analytical Data
-
Gene name
EIF4EBP3
- Application
-
Alternative Names
EIF4EBP3;Eukaryotic translation initiation factor 4E-binding Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60516
-
Expression Region
1-100aa
-
AA Sequence
MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI
-
Molecular Weight
26.9kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EIF4EBP3, a member of the eukaryotic translation initiation factor 4E-binding protein family, plays a critical role in the regulation of protein synthesis. By binding to the translation initiation factor eIF4E, EIF4EBP3 inhibits the formation of the eIF4F complex, thereby repressing cap-dependent translation of specific mRNAs. Dysregulation of EIF4EBP3 has been implicated in various diseases, including cancer and metabolic disorders, making it a potential target for therapeutic intervention. Research has also shown that EIF4EBP3 is involved in cellular stress responses and the regulation of cell growth, underscoring its importance in maintaining homeostasis. The production of recombinant EIF4EBP3 protein has gained significant interest, as it allows for the in-depth study of its biochemical properties and interactions. By employing techniques such as recombinant DNA technology and protein expression systems, researchers aim to elucidate the structure-function relationship of EIF4EBP3 and its role in translation regulation under different physiological and pathological conditions. Understanding these mechanisms can provide insights into therapeutic strategies that manipulate protein synthesis pathways, thereby offering potential avenues for treating diseases associated with EIF4EBP3 dysfunction. Overall, the study of recombinant EIF4EBP3 is pivotal in advancing our knowledge of translation control and its implications in health and disease.
