Analytical Data
-
Gene name
SLC8A1
- Application
-
Alternative Names
SLC8A1；CNC；NCX1；Sodium/calcium exchanger 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P32418
-
Expression Region
396-627aa
-
AA Sequence
VNTEVTENDPVSKIFFEQGTYQCLENCGTVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGDTQKEIRVGIIDDDIFEEDENFLVHLSNVKVSSEASEDGILEANHVSTLACLGSPSTATVTIFDDDHAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFLEIG
-
Molecular Weight
27.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC8A1, which encodes the sodium/calcium exchanger NCX1, plays a vital role in maintaining calcium homeostasis in cells. This protein is essential for various physiological processes, including cardiac function, smooth muscle contraction, and neuronal signaling. Disturbances in calcium regulation due to SLC8A1 dysfunction are implicated in several pathophysiological conditions, such as heart failure, arrhythmias, and neurodegenerative diseases. Recent studies have emphasized the importance of understanding the structure and function of SLC8A1, particularly its ion transport mechanisms and regulatory pathways. Recombinant protein research on SLC8A1 aims to elucidate these mechanisms and investigate potential pharmacological targets that could lead to the development of novel therapeutics. By producing the SLC8A1 protein in a controlled environment, scientists can examine its properties in isolation, perform biochemical assays, and test the effects of various compounds on its function. This research not only advances our fundamental knowledge of calcium signaling but also holds promise for therapeutic innovations that could alleviate diseases associated with dysregulated calcium transport. The ongoing exploration of SLC8A1 and its related pathways continues to provide insights into the intricate balance of ion transport in cellular physiology.
