Analytical Data
-
Gene name
FSHR
- Application
-
Alternative Names
FSHR;LGR1;Follicle-stimulating hormone receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P23945
-
Expression Region
18-366aa
-
AA Sequence
CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFS GFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQ NLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVG LSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGA SGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEA SLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAED NESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR
-
Molecular Weight
78 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FSHR, or Follicle-Stimulating Hormone Receptor, is a G protein-coupled receptor that plays a crucial role in reproductive biology by mediating the effects of follicle-stimulating hormone (FSH) on gonadal function. Research on FSHR is significant due to its essential role in gametogenesis and ovarian function, as well as its potential implications in fertility treatments and reproductive disorders. The expression and functionality of FSHR are vital for normal follicle development and spermatogenesis, making it a key target for studying endocrine regulation in both males and females. Furthermore, abnormalities in FSHR signaling pathways can lead to reproductive health issues, such as polycystic ovary syndrome (PCOS) or reduced fertility. The development of recombinant FSHR proteins has allowed scientists to investigate various aspects of its structure, signaling mechanisms, and ligand interactions at a molecular level, contributing to the understanding of FSHR's role in health and disease. These studies have significant implications for improving assisted reproductive technologies, developing novel contraceptives, and addressing infertility challenges. Additionally, insights gained from FSHR research can facilitate the design of targeted therapies for managing hormonal imbalances and reproductive disorders, underscoring the importance of this receptor in advancing reproductive health research.











