Cat: PA1000-992DB

Recombinant Human EIF2S1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EIF2S1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    EIF2S1;EIF2A;Eukaryotic translation initiation factor 2 subunit 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P05198

  • Expression Region

    1-315aa

  • AA Sequence

    MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSE LSRRRIRSINKLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCED KFTKSKTVYSILRHVAEVLEYTKDEQLESLFQRTAWVFDDKYKRPGYGAY DAFKHAVSDPSILDSLDLNEDEREVLINNINRRLTPQAVKIRADIEVACY GYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTTTLERTEGLSV LSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV DGDDDAEEMEAKAED

  • Molecular Weight

    40 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

EIF2S1, also known as eukaryotic translation initiation factor 2 subunit alpha (eIF2α), plays a pivotal role in the regulation of protein synthesis and cellular stress responses. Under normal cellular conditions, eIF2α is involved in the initiation of translation by forming a complex with initiator tRNA and other translation initiation factors. However, under stress conditions, such as viral infection or nutrient deprivation, eIF2α can undergo phosphorylation, leading to the inhibition of global protein synthesis while allowing the selective translation of specific mRNAs that promote cell survival. This dual role makes EIF2S1 a critical player in maintaining cellular homeostasis and responding to environmental challenges. Research into recombinant EIF2S1 has gained significant traction, as understanding its structure and function can provide insights into the mechanisms of translational control and stress adaptation. Furthermore, the potential for EIF2S1 to serve as a therapeutic target in diseases characterized by dysregulated protein synthesis, such as cancer and neurodegenerative disorders, underscores its importance in biomedical research. By exploring the biochemical characteristics and functional dynamics of recombinant EIF2S1, researchers aim to elucidate its role in various cellular processes and to leverage this knowledge for the development of novel therapeutic strategies. This makes EIF2S1 not only a fundamental component of the translational machinery but also a promising candidate for interventions in diseases associated with translation dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US