Analytical Data
-
Gene name
EIF2S1
- Application
-
Alternative Names
EIF2S1;EIF2A;Eukaryotic translation initiation factor 2 subunit 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P05198
-
Expression Region
1-315aa
-
AA Sequence
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSE LSRRRIRSINKLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCED KFTKSKTVYSILRHVAEVLEYTKDEQLESLFQRTAWVFDDKYKRPGYGAY DAFKHAVSDPSILDSLDLNEDEREVLINNINRRLTPQAVKIRADIEVACY GYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTTTLERTEGLSV LSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV DGDDDAEEMEAKAED
-
Molecular Weight
40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EIF2S1, also known as eukaryotic translation initiation factor 2 subunit alpha (eIF2α), plays a pivotal role in the regulation of protein synthesis and cellular stress responses. Under normal cellular conditions, eIF2α is involved in the initiation of translation by forming a complex with initiator tRNA and other translation initiation factors. However, under stress conditions, such as viral infection or nutrient deprivation, eIF2α can undergo phosphorylation, leading to the inhibition of global protein synthesis while allowing the selective translation of specific mRNAs that promote cell survival. This dual role makes EIF2S1 a critical player in maintaining cellular homeostasis and responding to environmental challenges. Research into recombinant EIF2S1 has gained significant traction, as understanding its structure and function can provide insights into the mechanisms of translational control and stress adaptation. Furthermore, the potential for EIF2S1 to serve as a therapeutic target in diseases characterized by dysregulated protein synthesis, such as cancer and neurodegenerative disorders, underscores its importance in biomedical research. By exploring the biochemical characteristics and functional dynamics of recombinant EIF2S1, researchers aim to elucidate its role in various cellular processes and to leverage this knowledge for the development of novel therapeutic strategies. This makes EIF2S1 not only a fundamental component of the translational machinery but also a promising candidate for interventions in diseases associated with translation dysregulation.











