Analytical Data
-
Gene name
FLCN
- Application
-
Alternative Names
FLCN；BHD；Folliculin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NFG4
-
Expression Region
1-342aa
-
AA Sequence
MNAIVALCHFCELHGPRTLFCTEVLHAPLPQGDGNEDSPGQGEQAEEEEGGIQMNSRMRA HSPAEGASVESSSPGPKKSDMCEGCRSLAAGHPGYISHDKETSIKYVSHQHPSHPQLFSI VRQACVRSLSCEVCPGREGPIFFGDEQHGFVFSHTFFIKDSLARGFQRWYSIITIMMDRI YLINSWPFLLGKVRGIIDELQGKALKVFEAEQFGCPQRAQRMNTAFTPFLHQRNGNAARS LTSLTSDDNLWACLHTSFAWLLKACGSRLTEKLLEGAPTEDTLVQMEKLAGEAGVLLPGP WPGWPWGGTSCLLSWQESLREGNAALNQPRTSLREAHPPISV
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The FLCN gene, which encodes the folliculin protein, is associated with Birt-Hogg-Dubé syndrome (BHDS), a rare genetic disorder characterized by skin tumors, lung cysts, and an elevated risk of renal cancers. Research into FLCN and its recombinant protein has gained significant attention due to its role in cellular processes such as energy metabolism, mTOR signaling, and tumor suppression. Mutations in the FLCN gene lead to the loss of functional folliculin, resulting in dysregulated cell growth and increased susceptibility to malignancies. Investigating the structure and function of recombinant FLCN protein is essential for understanding its role in tumorigenesis and the underlying mechanisms of BHDS. Additionally, the development of recombinant forms of the protein has potential therapeutic implications, as it may enable the identification of novel drug targets or the design of gene therapies aimed at restoring normal FLCN function. Furthermore, studying FLCN protein interactions within cellular pathways can provide insights into its functions beyond cancer, potentially elucidating its impact on metabolic disorders. The ongoing research aims not only to clarify the biology of folliculin but also to develop innovative strategies for diagnosing and treating conditions associated with FLCN mutations. This growing interest underscores the importance of FLCN protein in both basic science and clinical applications.
