Analytical Data
-
Gene name
RpII215
- Application
-
Alternative Names
RpII215；Rpii215；Rpo2-1；DNA-directed RNA polymerase II subunit RPB1
-
Species
Drosophila melanogaster
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P08775
-
Expression Region
1579-1881aa
-
AA Sequence
YSPTSPNYTASSPGGASPNYSPSSPNYSPTSPLYASPRYASTTPNFNPQSTGYSPSSSGYSPTSPVYSPTVQFQSSPSFAGSGSNIYSPGNAYSPSSSNYSPNSPSYSPTSPSYSPSSPSYSPTSPCYSPTSPSYSPTSPNYTPVTPSYSPTSPNYSASPQYSPASPAYSQTGVKYSPTSPTYSPPSPSYDGSPGSPQYTPGSPQYSPASPKYSPTSPLYSPSSPQHSPSNQYSPTGSTYSATSPRYSPNMSIYSPSSTKYSPTSPTYTPTARNYSPTSPMYSPTAPSHYSPTSPAYSPSSPT
-
Molecular Weight
33.6kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The RpII215 recombinant protein, derived from the Drosophila melanogaster RNA polymerase II, has gained significant attention in molecular biology and biochemistry research due to its crucial role in gene transcription. As a eukaryotic enzyme, RNA polymerase II is responsible for synthesizing messenger RNA (mRNA) from DNA templates, making it essential for proper gene expression and cellular function. The RpII215 subunit is a key component of the RNA polymerase II complex, influencing the enzyme's assembly, stability, and interaction with various transcription factors. Studying RpII215 helps researchers understand the intricate mechanisms of transcriptional regulation, which is vital for numerous biological processes, including development, differentiation, and response to environmental stimuli. Additionally, alterations in the function of RNA polymerase II, including the RpII215 subunit, are implicated in various diseases, including cancer and neurodegenerative disorders. By producing recombinant forms of RpII215, scientists can conduct in-depth structural and functional analyses, shedding light on its conformational dynamics, enzymatic activity, and interactions with other proteins. This research not only enhances our understanding of fundamental cellular processes but also opens avenues for therapeutic interventions aimed at diseases stemming from transcriptional dysregulation. Through these studies, insights into the molecular underpinnings of transcription provide a foundation for developing innovative strategies to manipulate gene expression for clinical benefits.
