Analytical Data
-
Gene name
MT1F
- Application
-
Alternative Names
MT1F；Metallothionein-1F
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P04733
-
Expression Region
1-59aa
-
AA Sequence
MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSC
-
Molecular Weight
7.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MT1F, a member of the metallothionein family, is a low-molecular-weight, cysteine-rich protein primarily involved in metal ion homeostasis and detoxification within cells. The study of MT1F has gained significant interest due to its potential role in various physiological and pathological processes, including antioxidant defense, cellular proliferation, and apoptosis regulation. Research indicates that MT1F may play a critical role in mitigating oxidative stress and protecting cellular components from heavy metal toxicity, contributing to its relevance in cancer biology and neurodegenerative diseases. Furthermore, altered expression levels of MT1F have been associated with different types of cancer, suggesting a potential biomarker for diagnosis and prognosis. Investigations into the structural properties and functional mechanisms of MT1F are essential for understanding its biological significance and could pave the way for therapeutic applications targeting metal-related disorders. Additionally, the recombinant production of MT1F enables detailed studies of its biochemical properties and interactions with metal ions, providing insights into its functional versatility.
