Analytical Data
-
Gene name
EFNA3
- Application
-
Alternative Names
EFNA3；EFL2；EPLG3；LERK3;Ephrin-A3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P52797
-
Expression Region
23-211aa
-
AA Sequence
QGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVG PGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKF SEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSH SGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSVDHHHHHH
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EFNA3, or Ephrin-A3, is a crucial member of the ephrin family, which plays a significant role in cell communication, particularly in the development of the nervous system. It interacts with Eph receptors, facilitating bidirectional signaling that influences cell adhesion, migration, and survival. This protein is involved in various biological processes, including angiogenesis, neural patterning, and tumor progression. Research has shown that abnormalities in EFNA3 expression are associated with several diseases, including cancers and neurodegenerative disorders. The production of recombinant EFNA3 proteins has facilitated studies into its structure-function relationships, signaling pathways, and potential therapeutic applications. Understanding EFNA3's biological roles could unveil new strategies for targeting diseases where these pathways are dysregulated, making it a focus of current biomedical research. Additionally, the exploration of EFNA3 in the context of tissue engineering, regenerative medicine, and cancer therapeutics continues to demonstrate its potential in novel treatment approaches.
