Analytical Data
-
Gene name
HCRTR2
- Application
-
Alternative Names
HCRTR2；Orexin receptor type 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43614
-
Expression Region
1-54aa
-
AA Sequence
MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYE
-
Molecular Weight
32.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HCRTR2 (Hypocretin Receptor 2) is a G-protein-coupled receptor that plays a crucial role in the regulation of arousal, energy balance, and wakefulness. It is primarily activated by hypocretins, also known as orexins, which are neuropeptides produced in the hypothalamus. Research into HCRTR2 has gained attention due to its implications in sleep disorders, such as narcolepsy, where a deficiency of hypocretins is observed. The receptor is implicated in various physiological functions, including appetite control and stress response, making it a significant target for drug development aimed at treating metabolic and psychiatric disorders. Understanding the structure and function of HCRTR2 through recombinant protein studies can provide insights into its signaling mechanisms and interactions with other biological pathways. Moreover, the expression of HCRTR2 as a recombinant protein allows for detailed studies of its binding properties, pharmacological profiles, and potential as a therapeutic target. Through these investigations, researchers aim to elucidate the role of HCRTR2 in human health and disease, paving the way for novel treatment strategies for conditions linked to hypocretin signaling dysfunction.
