Cat: PA1000-963DB

Recombinant Human EDAR Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EDAR

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    EDAR;DL;Tumor necrosis factor receptor superfamily member EDAR

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UNE0

  • Expression Region

    27-448aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSEYSNCGENEYYNQTTGLCQECPPCGPG EEPYLSCGYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLT PGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATS GASANFPGTSGSSTLSPFQHAHKELSGQGHLATALIIAMSTIFIMAIAIV LIIMFYILKTKPSAPACCTSHPGKSVEAQVSKDEEKKEAPDNVVMFSEKD EFEKLTATPAKPTKSENDASSENEQLLSRSVDSDEEPAPDKQGSPELCLL SLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGVVEGLSPTELPFDCL EKTSRMLSSTYNSEKAVVKTWRHLAESFGLKRDEIGGMTDGMQLFDRIST AGYSIPELLTKLVQIERLDAVESLCADILEWAGVVPPASQPHAAS

  • Molecular Weight

    48 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

EDAR (Ectodysplasin A Receptor) is a member of the tumor necrosis factor receptor (TNFR) superfamily, primarily involved in ectodermal development, particularly in the formation of skin, hair, and teeth. Mutations in the EDAR gene have been linked to a variety of ectodermal dysplasias, leading to phenotypic variations such as changes in hair texture and dental anomalies. The study of recombinant EDAR proteins has gained prominence as researchers aim to elucidate the receptor's structure-function relationship and its signaling pathways. By generating recombinant EDAR proteins, scientists are able to mimic the natural receptor's interaction with its ligand, ectodysplasin A (EDA), and assess their role in cellular responses and developmental processes. This research is critical for understanding the molecular mechanisms underlying ectodermal development and for developing potential therapeutic strategies for ectodermal dysplasia disorders. Furthermore, by investigating how EDAR signaling can be modulated, there is the potential to discover novel approaches to enhance skin and hair regeneration, which is of great interest in the field of regenerative medicine. Overall, the research into recombinant EDAR proteins represents a significant advancement in developmental biology, offering insights that could not only improve our understanding of genetic conditions but also lay the groundwork for innovative treatment options.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US