Analytical Data
-
Gene name
ECSIT
- Application
-
Alternative Names
ECSIT;Evolutionarily conserved signaling intermediate in Toll pathway. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
E9PAN9
-
Expression Region
19-217aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSGTCGAALTGTSISQVPLPKDSTGAADP PQPHIVGIQSPDQQAALARHNPARPVFVEGPFSLWLRNKCVYYHILRADL LPPEEREVEETPEEWNLYYPMQLDLEYVRSGWDNYEFDINEVEEGPVFAM CMAGAHDQATMAKWIQGLQETNPTLAQIPVVFRLAGSTRELQTSSAGLEE PPLPEDHQEEDDNLQRQQQGQS
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ECSIT (Evolutionarily Conserved Signaling Intermediate in Toll pathways) is a critical protein that plays a pivotal role in the immune response and various cellular signaling pathways. Research into ECSIT has gained momentum due to its involvement in the Toll-like receptor (TLR) signaling cascade, which is integral to the innate immune system. TLRs recognize pathogen-associated molecular patterns, leading to the activation of immune responses and inflammation. ECSIT serves as a scaffold that interacts with different signaling molecules, facilitating the transduction of signals from TLRs to downstream effectors, such as NF-κB and MAPK pathways. Dysregulation of ECSIT has been linked to various diseases, including autoimmune disorders and cancer, highlighting its potential as a therapeutic target. Recent studies have focused on understanding the structural properties of ECSIT and its interactions with other proteins, aiming to elucidate its role in health and disease. Advances in techniques such as cryo-electron microscopy and X-ray crystallography have enabled researchers to investigate the three-dimensional structure of ECSIT, providing insights into its functional mechanisms. With a deeper understanding of ECSIT's role in immune signaling, researchers hope to develop novel strategies for modulating immune responses in various clinical contexts, paving the way for innovative treatments for inflammatory diseases and immunological disorders.
