Analytical Data
-
Gene name
CCNJL
- Application
-
Alternative Names
CCNJL；Cyclin-J-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IV13
-
Expression Region
315-435aa
-
AA Sequence
MVPGTPPTPTQVLFQPPAYPALGQPATTLAQFQTPVQDLCLAYRDSLQAHRSGSLLSGSTGSSLHTPYQPLQPLDMCPVPVPASLSMHMAIAAEPRHCLATTYGSSYFSGSHMFPTGCFDR
-
Molecular Weight
14.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on CCNJL (Cysteine-rich with EGF-like domain 1) recombinant protein has gained significant attention due to its potential roles in various biological processes and disease mechanisms. CCNJL is part of the CCN family of proteins, which are known to influence cell proliferation, differentiation, and extracellular matrix formation. Its involvement in developmental processes and tissue repair, alongside its implications in pathological conditions such as cancer and fibrosis, makes CCNJL a key target for scientific investigation. Studies have indicated that CCNJL may interact with various signaling pathways, affecting cellular responses to growth factors and stress. Moreover, the ability to produce recombinant CCNJL allows researchers to elucidate its functional properties, investigate its interactions with other biomolecules, and explore its therapeutic potential. As such, understanding the structure and activity of CCNJL through recombinant technologies could lead to novel insights into its roles in health and disease, paving the way for potential biomedical applications.
