Analytical Data
-
Gene name
pstS1
- Application
-
Alternative Names
pstS1；TIL4；Toll-like receptor 2
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P9WGU0
-
Expression Region
24-373aa
-
AA Sequence
CGSKPPSGSPETGAGAGTVATTPASSPVTLAETGSTLLYPLFNLWGPAFHERYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAAHKGLMNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAFLHWAITDGNKASFLDQVHFQPLPPAVVKLSDALIATIS
-
Molecular Weight
39.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The pstS1 protein is a key component of the phosphate transport system in various organisms, playing a critical role in the uptake and regulation of phosphate, which is essential for many cellular processes, including energy production, signaling, and metabolism. In response to phosphate starvation, pstS1 expression is often upregulated, indicating its importance in adapting to nutrient-limited environments. The study of pstS1 recombinant proteins has garnered attention due to their potential applications in biotechnology and agriculture, particularly in the development of crop varieties with enhanced phosphate uptake capabilities. Understanding the structural and functional properties of pstS1 can also provide insights into the molecular mechanisms of phosphate transport, which could lead to novel strategies for managing soil fertility and optimizing nutrient use efficiency in plants. Furthermore, investigations into pstS1’s interactions with other proteins and its regulatory networks can unveil new targets for genetic engineering aimed at improving plant resilience and productivity under varying environmental conditions. Overall, the research on pstS1 recombinant proteins serves as a foundational approach to addressing global challenges related to food security and sustainable agricultural practices.
