Analytical Data
-
Gene name
KCNJ10
- Application
-
Alternative Names
KCNJ10；ATP-sensitive inward rectifier potassium channel 10
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P78508
-
Expression Region
276-379aa
-
AA Sequence
DFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIA DFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVR ISNV
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KCNJ10, also known as the inwardly rectifying potassium channel 10, is a member of the KCNJ family of potassium ion channels, which are critical for maintaining potassium homeostasis and regulating cellular excitability. Mutations in the KCNJ10 gene have been linked to various disorders, particularly those affecting the brain and kidney, such as East syndrome, characterized by severe neurological features and sensorineural hearing loss. Research into the recombinant expression of KCNJ10 protein is crucial for understanding its physiological roles and the consequences of its dysfunction. By producing and characterizing recombinant KCNJ10, scientists can study the channel's biophysical properties, gating mechanisms, and interactions with regulatory proteins. This research also holds significance for the development of potential therapeutic strategies targeting KCNJ10-related diseases. The advancement of techniques such as cryo-electron microscopy and patch-clamp electrophysiology enhances our ability to elucidate the structural and functional nuances of KCNJ10, paving the way for a deeper understanding of its role in cellular signaling and disease pathology. This knowledge could contribute to the design of drugs that modulate KCNJ10 activity, offering new avenues for treatment of associated conditions.
