Cat: PA1000-928DB

Recombinant Human DTD2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DTD2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DTD2;C14orf126;D-aminoacyl-tRNA deacylase 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96FN9

  • Expression Region

    1-168aa

  • AA Sequence

    MAEGSRIPQARALLQQCLHARLQIRPADGDVAAQWVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEARVVVEHGTYGNRQVLKLDTNGPFTHLIEF

  • Molecular Weight

    34.7kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of DTD2 (dGTP diphosphate ribosyltransferase 2) recombinant protein has garnered significant interest in the field of molecular biology and biochemistry due to its potential implications in cellular stress responses and nucleotide metabolism. DTD2 is an enzyme that plays a crucial role in maintaining nucleotide pool homeostasis by catalyzing the transfer of ADP-ribose to target proteins, which may regulate various cellular processes, including DNA repair and apoptosis. Dysregulation of DTD2 has been associated with several diseases, including cancer and neurodegenerative disorders, indicating its importance in cellular function and survival. Furthermore, as a member of the ADP-ribosyltransferase family, the understanding of DTD2's structure and function could provide insights into the broader mechanisms of post-translational modifications. The ability to produce recombinant DTD2 protein enables researchers to study its enzymatic activity, identify potential substrates, and explore its interactions with other biomolecules in more detail. This research could pave the way for developing targeted therapies that modulate DTD2 activity, offering new avenues for treating diseases linked to nucleotide metabolism disruptions. Overall, the investigation of DTD2 recombinant protein highlights its essential role in cellular physiology and opens up new possibilities for therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US