Cat: PA1000-9543

Recombinant Human ETRA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ETRA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ETRA;ETA;ETRA;Endothelin-1 receptor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P25101

  • Expression Region

    1-427aa

  • AA Sequence

    METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVT THQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNAT LLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDH NDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPL VTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEF YQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLM DYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPM NGTSIQWKNHDQNNHNTDRSSHKDSMN

  • Molecular Weight

    75 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ETRA (Estrogen Receptor beta) is a nuclear receptor that plays a critical role in mediating the effects of estrogens on various physiological processes, including development, reproduction, and metabolism. Recent studies have highlighted its significance in cancer biology, particularly in breast and prostate cancers, where ETRA can act as a tumor suppressor or promoter depending on the cellular context. The complexity of ETRA's role in these processes has spurred research into the design and development of recombinant ETRA proteins to elucidate its functions at the molecular level. By producing ETRA as a recombinant protein, researchers aim to study its structure, interactions with specific ligands, and downstream signaling pathways, thereby enhancing our understanding of its biological significance. The generation of recombinant ETRA also facilitates the exploration of its therapeutic potential, as modulation of its activity may offer novel strategies for cancer treatment and hormone-related disorders. Furthermore, the recombinant protein can be used as a tool in drug screening assays, helping to identify compounds that specifically target ETRA's signaling pathway. Overall, the study of recombinant ETRA proteins represents a promising avenue for advancing our knowledge of estrogen signaling and its implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US